J0(3) Linux Programmer's Manual J0(3)NAME
j0, j0f, j0l, j1, j1f, j1l, jn, jnf, jnl, y0, y0f, y0l, y1, y1f, y1l, yn, ynf, ynl - Bessel functions
SYNOPSIS
#include <math.h>
double j0(double x);
double j1(double x);
double jn(int n, double x);
double y0(double x);
double y1(double x);
double yn(int n, double x);
float j0f(float x);
float j1f(float x);
float jnf(int n, float x);
float y0f(float x);
float y1f(float x);
float ynf(int n, float x);
long double j0l(long double x);
long double j1l(long double x);
long double jnl(int n, long double x);
long double y0l(long double x);
long double y1l(long double x);
long double ynl(int n, long double x);
DESCRIPTION
The j0() and j1() functions return Bessel functions of x of the first kind of orders 0 and 1, respectively. The jn() function returns the
Bessel function of x of the first kind of order n.
The y0() and y1() functions return Bessel functions of x of the second kind of orders 0 and 1, respectively. The yn() function returns the
Bessel function of x of the second kind of order n.
For the functions y0(), y1() and yn(), the value of x must be positive. For negative values of x, these functions return -HUGE_VAL.
The j0f() etc. and j0l() etc. functions are versions that take and return float and long double values, respectively.
CONFORMING TO
The functions returning double conform to SVID 3, BSD 4.3, XPG4, POSIX 1003.1-2001. The other functions exist by analogy, and exist on sev-
eral platforms.
BUGS
There are errors of up to 2e-16 in the values returned by j0(), j1() and jn() for values of x between -8 and 8.
2002-08-25 J0(3)
Check Out this Related Man Page
J0(3) Linux Programmer's Manual J0(3)NAME
j0, j0f, j0l, j1, j1f, j1l, jn, jnf, jnl, y0, y0f, y0l, y1, y1f, y1l, yn, ynf, ynl - Bessel functions
SYNOPSIS
#include <math.h>
double j0(double x);
double j1(double x);
double jn(int n, double x);
double y0(double x);
double y1(double x);
double yn(int n, double x);
float j0f(float x);
float j1f(float x);
float jnf(int n, float x);
float y0f(float x);
float y1f(float x);
float ynf(int n, float x);
long double j0l(long double x);
long double j1l(long double x);
long double jnl(int n, long double x);
long double y0l(long double x);
long double y1l(long double x);
long double ynl(int n, long double x);
DESCRIPTION
The j0() and j1() functions return Bessel functions of x of the first kind of orders 0 and 1, respectively. The jn() function returns the
Bessel function of x of the first kind of order n.
The y0() and y1() functions return Bessel functions of x of the second kind of orders 0 and 1, respectively. The yn() function returns the
Bessel function of x of the second kind of order n.
For the functions y0(), y1() and yn(), the value of x must be positive. For negative values of x, these functions return -HUGE_VAL.
The j0f() etc. and j0l() etc. functions are versions that take and return float and long double values, respectively.
CONFORMING TO
The functions returning double conform to SVID 3, BSD 4.3, XPG4, POSIX 1003.1-2001. The other functions exist by analogy, and exist on sev-
eral platforms.
BUGS
There are errors of up to 2e-16 in the values returned by j0(), j1() and jn() for values of x between -8 and 8.
2002-08-25 J0(3)
Hi all, my first post here. I'm trying to load hypermail on my Mac (Tiger 10.4.11). It seemed to install just fine, but when I run the test build I get this error:
dyld: Library not loaded: /usr/local/lib/libpcre.0.dylib
Referenced from: /Users/sstark/Desktop/hypermail/tests/../src/hypermail... (4 Replies)
I recently installed Centos 6 and is my SOHO firewall/router. The small network is layout like such:
|--eth0(WAN)
Centos 6(firewall/router)
|---eth1(LAN)
|
Switch
|
|
LAN(192.168.3.0/27)
|
|
PCs ----Laptops---Printer... (8 Replies)
I've an HTML page where the pie chart is generated with google java code with the required input values in UNIX.
The HMTL page is generated in UNIX and then when it loads in browser, the code is interpreted thought internet and the pie chart is generated. This is done by the java code in the... (4 Replies)
I am wondering if someone can help a brother out. I am trying to create a DB using a GUI and when I am about to finish, it gets stuck. I hit finish but nothing happens. Any help from the community will be highly appreciated.
... (0 Replies)
Heyas
I've been working on my project TUI (Text User Interface) for quite some time now, its a hobby project, so nothing i sit in front of 8hrs/day.
Since the only 'real' programming language i knw is Visual Basic, based upon early steps with MS-Batch files. When i 'joined' linux 3 years ago,... (7 Replies)
Hi Experts,
I am new to python and AIX. I am trying to install Python 2.7 or python 3.2 on AIX 7.1 but getting the bellow error. could you please let me know how to resolve this.
Note: Same has been installed on Linux Redhat successfully.
$ ./configure --enable-shared
##... (1 Reply)
Hi,
Here is this weird thing happening here. I mounted RHEL 6.6 DVD on a directoy /a, I am trying to copy it's content to another folder by using command:
cp -pr /a/* /new/folder
But while I run ls -lrt on both locations it show me difference in number of files. Any specific reason for that.... (5 Replies)
I have a fasta file as follows
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
I have a text file in the following format
>Homo sapiens
KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS
CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS... (2 Replies)