Linux and UNIX Man Pages

Linux & Unix Commands - Search Man Pages

ynl(3) [redhat man page]

J0(3)							     Linux Programmer's Manual							     J0(3)

NAME
j0, j0f, j0l, j1, j1f, j1l, jn, jnf, jnl, y0, y0f, y0l, y1, y1f, y1l, yn, ynf, ynl - Bessel functions SYNOPSIS
#include <math.h> double j0(double x); double j1(double x); double jn(int n, double x); double y0(double x); double y1(double x); double yn(int n, double x); float j0f(float x); float j1f(float x); float jnf(int n, float x); float y0f(float x); float y1f(float x); float ynf(int n, float x); long double j0l(long double x); long double j1l(long double x); long double jnl(int n, long double x); long double y0l(long double x); long double y1l(long double x); long double ynl(int n, long double x); DESCRIPTION
The j0() and j1() functions return Bessel functions of x of the first kind of orders 0 and 1, respectively. The jn() function returns the Bessel function of x of the first kind of order n. The y0() and y1() functions return Bessel functions of x of the second kind of orders 0 and 1, respectively. The yn() function returns the Bessel function of x of the second kind of order n. For the functions y0(), y1() and yn(), the value of x must be positive. For negative values of x, these functions return -HUGE_VAL. The j0f() etc. and j0l() etc. functions are versions that take and return float and long double values, respectively. CONFORMING TO
The functions returning double conform to SVID 3, BSD 4.3, XPG4, POSIX 1003.1-2001. The other functions exist by analogy, and exist on sev- eral platforms. BUGS
There are errors of up to 2e-16 in the values returned by j0(), j1() and jn() for values of x between -8 and 8. 2002-08-25 J0(3)

Check Out this Related Man Page

J0(3)							     Linux Programmer's Manual							     J0(3)

NAME
j0, j0f, j0l, j1, j1f, j1l, jn, jnf, jnl, y0, y0f, y0l, y1, y1f, y1l, yn, ynf, ynl - Bessel functions SYNOPSIS
#include <math.h> double j0(double x); double j1(double x); double jn(int n, double x); double y0(double x); double y1(double x); double yn(int n, double x); float j0f(float x); float j1f(float x); float jnf(int n, float x); float y0f(float x); float y1f(float x); float ynf(int n, float x); long double j0l(long double x); long double j1l(long double x); long double jnl(int n, long double x); long double y0l(long double x); long double y1l(long double x); long double ynl(int n, long double x); DESCRIPTION
The j0() and j1() functions return Bessel functions of x of the first kind of orders 0 and 1, respectively. The jn() function returns the Bessel function of x of the first kind of order n. The y0() and y1() functions return Bessel functions of x of the second kind of orders 0 and 1, respectively. The yn() function returns the Bessel function of x of the second kind of order n. For the functions y0(), y1() and yn(), the value of x must be positive. For negative values of x, these functions return -HUGE_VAL. The j0f() etc. and j0l() etc. functions are versions that take and return float and long double values, respectively. CONFORMING TO
The functions returning double conform to SVID 3, BSD 4.3, XPG4, POSIX 1003.1-2001. The other functions exist by analogy, and exist on sev- eral platforms. BUGS
There are errors of up to 2e-16 in the values returned by j0(), j1() and jn() for values of x between -8 and 8. 2002-08-25 J0(3)
Man Page

14 More Discussions You Might Find Interesting

1. Shell Programming and Scripting

Awk script

I have following text scaffold_1 phytozome6 gene 12632 13612 . + . ID=PT_0001s00200;Name=PT_0001s00200 scaffold_1 phytozome6 mRNA 12632 13612 . + . ID=PAC:18235173;Name=PT_0001s00200.1;PACid=18235173;Parent=PT_0001s00200... (29 Replies)
Discussion started by: shen
29 Replies

2. UNIX for Dummies Questions & Answers

Macintosh build error: dyld: Library not loaded: /usr/local/lib/libpcre.0.dylib

Hi all, my first post here. I'm trying to load hypermail on my Mac (Tiger 10.4.11). It seemed to install just fine, but when I run the test build I get this error: dyld: Library not loaded: /usr/local/lib/libpcre.0.dylib Referenced from: /Users/sstark/Desktop/hypermail/tests/../src/hypermail... (4 Replies)
Discussion started by: slugger415
4 Replies

3. Cybersecurity

iptables Local Lan Issues

I recently installed Centos 6 and is my SOHO firewall/router. The small network is layout like such: |--eth0(WAN) Centos 6(firewall/router) |---eth1(LAN) | Switch | | LAN(192.168.3.0/27) | | PCs ----Laptops---Printer... (8 Replies)
Discussion started by: metallica1973
8 Replies

4. Shell Programming and Scripting

Download dynamic generated image from HTML page

I've an HTML page where the pie chart is generated with google java code with the required input values in UNIX. The HMTL page is generated in UNIX and then when it loads in browser, the code is interpreted thought internet and the pie chart is generated. This is done by the java code in the... (4 Replies)
Discussion started by: Amutha
4 Replies

5. Solaris

DBCA Issues

I am wondering if someone can help a brother out. I am trying to create a DB using a GUI and when I am about to finish, it gets stuck. I hit finish but nothing happens. Any help from the community will be highly appreciated. ... (0 Replies)
Discussion started by: newborndba
0 Replies

6. Shell Programming and Scripting

Transpose Second column only

Hi Folks, My input file is like this cat input abcd:efgh:jklm 123,456,67,78,89,90 hi:kil:op 76,78,12,3456, unix:linux:shell:bash 111,111 My expected output abcd:efgh:jklm hi:kil:op unix:linux:shell:bash 123 76 111 456 78 111 67 12 78 3456 89 90 (5 Replies)
Discussion started by: jacobs.smith
5 Replies

7. Shell Programming and Scripting

Display-performance in terminal, bash or python?

Heyas I've been working on my project TUI (Text User Interface) for quite some time now, its a hobby project, so nothing i sit in front of 8hrs/day. Since the only 'real' programming language i knw is Visual Basic, based upon early steps with MS-Batch files. When i 'joined' linux 3 years ago,... (7 Replies)
Discussion started by: sea
7 Replies

8. Shell Programming and Scripting

How to add nodev for /dev/shm partition in Linux using shell script?

Hi, Please guide me how to add nodev option for /dev/shm partition. I am new to scripting and looking to do via command line. Thanks Litu (13 Replies)
Discussion started by: Litu1988
13 Replies

9. AIX

Python on AIX-Need urgent Help

Hi Experts, I am new to python and AIX. I am trying to install Python 2.7 or python 3.2 on AIX 7.1 but getting the bellow error. could you please let me know how to resolve this. Note: Same has been installed on Linux Redhat successfully. $ ./configure --enable-shared ##... (1 Reply)
Discussion started by: Tamil_Arasan
1 Replies

10. Red Hat

Copy mismatch while copying RHEL DVD to folder

Hi, Here is this weird thing happening here. I mounted RHEL 6.6 DVD on a directoy /a, I am trying to copy it's content to another folder by using command: cp -pr /a/* /new/folder But while I run ls -lrt on both locations it show me difference in number of files. Any specific reason for that.... (5 Replies)
Discussion started by: nixhead
5 Replies

11. Shell Programming and Scripting

Matching column value from 2 different file using awk and append value from different column

Hi, I have 2 csv files. a.csv HUAWEI,20LMG011_DEKET_1296_RTN-980_IDU-1-11-ISV3-1(to LAMONGAN_M),East_Java,20LMG011_DEKET_1296_RTN-980_IDU-1,20LMG011,20LMG 027_1287_LAMONGAN_RTN980_IDU1,20LMG027,1+1(HSB),195.675,20LMG011-20LMG027,99.9995,202.6952012... (7 Replies)
Discussion started by: tententen
7 Replies

12. Shell Programming and Scripting

How to enable rh-python34 from bash shell script, default python is 2.6 version.?

On our server default python version is 2.6, how to enable rh-python34 via bash shell. Thanks a lot for the helpful info. (7 Replies)
Discussion started by: cplusplus1
7 Replies

13. Shell Programming and Scripting

Shorten header of protein sequences in fasta file to only organism name

I have a fasta file as follows >sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3 MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
Discussion started by: jerrild
3 Replies

14. Shell Programming and Scripting

Adding sequential index to duplicate strings

I have a text file in the following format >Homo sapiens KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS... (2 Replies)
Discussion started by: jerrild
2 Replies