NAN(3) libc math functions NAN(3)NAME
nan, nanf, nanl - return 'Not a Number'
SYNOPSIS
#include <math.h>
double nan(const char *tagp);
float nanf(const char *tagp);
long double nanl(const char *tagp);
DESCRIPTION
These functions return a representation (determined by tagp) of a quiet NaN. If the implementation does not support quiet NaNs, these func-
tions return zero.
The call nan("char-sequence") is equivalent to strtod ("NAN(char-sequence)",NULL) and similarly calls to nanf and nanl are equivalent to
analogous calls to strtof and strtold.
The argument tagp is used in an unspecified manner. On IEEE 754 systems, there are many representations of NaN, and tagp selects one. On
other systems it may do nothing.
CONFORMING TO
C99. See also IEC 559 and the appendix with recommended functions in IEEE 754/IEEE 854.
SEE ALSO isnan(3), strtod(3)GNU 2002-08-10 NAN(3)
Check Out this Related Man Page
NAN(3) Linux Programmer's Manual NAN(3)NAME
nan, nanf, nanl - return 'Not a Number'
SYNOPSIS
#include <math.h>
double nan(const char *tagp);
float nanf(const char *tagp);
long double nanl(const char *tagp);
Link with -lm.
Feature Test Macro Requirements for glibc (see feature_test_macros(7)):
nan(), nanf(), nanl():
_XOPEN_SOURCE >= 600 || _ISOC99_SOURCE || _POSIX_C_SOURCE >= 200112L;
or cc -std=c99
DESCRIPTION
These functions return a representation (determined by tagp) of a quiet NaN. If the implementation does not support quiet NaNs, these
functions return zero.
The call nan("char-sequence") is equivalent to:
strtod("NAN(char-sequence)", NULL);
Similarly, calls to nanf() and nanl() are equivalent to analogous calls to strtof(3) and strtold(3).
The argument tagp is used in an unspecified manner. On IEEE 754 systems, there are many representations of NaN, and tagp selects one. On
other systems it may do nothing.
VERSIONS
These functions first appeared in glibc in version 2.1.
CONFORMING TO
C99, POSIX.1-2001. See also IEC 559 and the appendix with recommended functions in IEEE 754/IEEE 854.
SEE ALSO isnan(3), strtod(3), math_error(7)COLOPHON
This page is part of release 3.27 of the Linux man-pages project. A description of the project, and information about reporting bugs, can
be found at http://www.kernel.org/doc/man-pages/.
GNU 2010-09-20 NAN(3)
Hello
#!bin/ksh
sqlplus -s system/manager < |grep '^ORA' |uniq
select * from kk;
set echo on
show spool on
end;
/
EOF
save test.sh
sh test.sh
results
ORA-00942: table or view does not exist (3 Replies)
i am translating <FreeBSD handbook> to Chinese.So,i have a word which i don`t kown how to describe within the professionanl field.That is "deltas".The entire sentence is "all ports being expressed as deltas to their original source."
Is there anybody can explain this word in that sentence.
... (3 Replies)
Hi
I am abigginer to unix .I have a file which contains data like this .
fiusdcanlt_fmrbgmusd1_run 07/23/2012 20:11:18 07/23/2012 20:12:20 SU 10861341/1
fiusdcanlt_fmrbgmusd2_run 07/23/2012 20:12:22 07/23/2012 20:21:26 SU 10861341/1
fiusdcanlt_fmrbgmusd3_run 07/23/2012... (7 Replies)
Hi All,
In the output of TOP command in my unix system, i monitored that some process has utilization more than 100% even some process has 4000% utilisation.
Please help me understand how it is possible to show more than 100% utilization.
Please see the screenshot below:... (2 Replies)
I have a fasta file as follows
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)